Tài liệu Nghiên cứu dịch tễ học bệnh viêm phế quản truyền nhiễm (infectious bronchitis – ib) ở gà nuôi tại một số tỉnh miền bắc việt nam tt

  • Số trang: 27 |
  • Loại file: PDF |
  • Lượt xem: 38 |
  • Lượt tải: 0
dangvantuan

Tham gia: 02/08/2015

Mô tả:

HỌC VIỆN NÔNG NGHIỆP VIỆT NAM NGUYỄN THỊ LOAN NGHIÊN CỨU DỊCH TỄ HỌC BỆNH VIÊM PHẾ QUẢN TRUYỀN NHIỄM (INFECTIOUS BRONCHITIS - IB) Ở GÀ NUÔI TẠI MỘT SỐ TỈNH PHÍA BẮC VIỆT NAM Chuyên ngành: Dịch tễ học thú y Mã số: 9.64.01.08 TÓM TẮT LUẬN ÁN TIẾN SĨ NHÀ XUẤT BẢN HỌC VIỆN NÔNG NGHIỆP - 2018 Công trình hoàn thành tại: HỌC VIỆN NÔNG NGHIỆP VIỆT NAM Người hướng dẫn khoa học: 1. PGS. TS. Lê Văn Phan 2. TS. Huỳnh Thanh Phương Phản biện 1: PGS.TS. Nguyễn Viết Không Viện Thú y Phản biện 2: PGS.TS. Tô Long Thành Trung tâm Chẩn đoán thú y trung ương Phản biện 3: TS. Phan Quang Minh Cục Thú y Luận án sẽ được bảo vệ trước Hội đồng Đánh giá luận án cấp Học viện họp tại: Học viện Nông nghiệp Việt Nam Vào hồi giờ phút, ngày tháng năm 2018 Có thể tìm hiểu luận án tại: Thư viện Quốc gia Việt Nam Thư viện Lương Định Của - Học viện Nông nghiệp Việt Nam 2 PHẦN 1. MỞ ĐẦU 1.1. TÍNH CẤP THIẾT CỦA ĐỀ TÀI Tuy ngành công nghiệp chăn nuôi gà đang ngày càng phát triển nhưng vẫn còn gặp không ít khó khăn nhất là vấn đề dịch bệnh trong đó phải kể đến bệnh viêm phế quản truyền nhiễm ở gà. Là một bệnh truyền nhiễm nguy hiểm, lây lan nhanh và gây thiệt hại kinh tế nặng nề, không những vậy do tính chất phức tạp của mầm bệnh, virus gây bệnh có nhiều serotype, dễ biến đổi nên bệnh rất khó kiểm soát. Những vụ dịch vẫn xảy ra thường là kết quả của sự lây nhiễm với các chủng khác về serotype so với các chủng vacxin. Vacxin sống đã được phát triển để chống lại một số serotype mới của IBV. Tuy nhiên, do ngày càng có nhiều biến chủng IBV mới xuất hiện khiến cho việc khống chế bệnh vẫn còn là một vấn đề nan giải. Vì vậy việc điều tra dịch tễ học IB, nghiên cứu và tìm ra những serotype IBV phổ biến lưu hành trong mỗi khu vực là rất quan trọng trong công tác kiểm soát bệnh. Tuy nhiên từ trước tới nay, câu hỏi về đặc điểm dịch tễ học IB, các serotype IBV lưu hành ra sao ở Việt Nam vẫn còn chưa có câu trả lời cụ thể và thỏa đáng. Để có thêm thông tin về các chủng IBV đang lưu hành, sự phân bố của IB ở Việt Nam, đặc biệt là ở các tỉnh miền Bắc nơi các đàn gà tập trung chủ yếu (chiếm tới 75% đàn gà cả nước), nghiên cứu các đặc tính sinh học cũng như sinh học phân tử của mầm bệnh, tìm ra các yếu tố nguy cơ liên quan đến dịch IB nhằm kiểm soát bệnh, nâng cao hiệu quả chăn nuôi, chúng tôi đã tiến hành nghiên cứu đề tài. 1.2. MỤC TIÊU NGHIÊN CỨU - Xác định được các đặc điểm dịch tễ, sự phân bố của các chủng IBV để làm cơ sở đề xuất các biện pháp phòng chống IB (tiêm phòng vacxin) nhằm tạo điều kiện cho chăn nuôi phát triển bền vững. - Chẩn đoán, phân lập và khảo sát được đặc tính sinh học của IBV gây bệnh tại một số tỉnh miền Bắc Việt Nam, giai đoạn 2014–2017. 1.3. PHẠM VI NGHIÊN CỨU - Nghiên cứu đặc điểm dịch tễ IB ở gà tại 5 tỉnh miền Bắc Việt Nam gồm: Bắc Ninh, Hà Nội, Hải Phòng, Hưng Yên, Thái Nguyên giai đoạn 2014-2017. - Nghiên cứu một số yếu tố nguy cơ lây lan dịch trên địa bàn nghiên cứu trong thời gian từ 2014–2017. - Nghiên cứu đặc điểm bệnh lý IB ở gà trên địa bàn nghiên cứu; đặc tính sinh học và sinh học phân tử của các chủng IBV lưu hành trên địa bàn nghiên cứu trong khoảng thời gian từ 2014–2015. 1.4. NHỮNG ĐÓNG GÓP MỚI CỦA ĐỀ TÀI - Khảo sát dịch bệnh IB tại 5 tỉnh phía Bắc Việt Nam trên cơ sở xác định lâm sàng, giám định bệnh lý và phân tử, khẳng định IBV thường xuyên lưu hành và có tỷ lệ mắc 1 và chết đáng quan tâm trong đàn gà nuôi hướng trứng. - Đã phân lập được 10 chủng IBV, xác định được đầy đủ các đặc tính sinh học, virus học của 3 chủng cường độc là VNUA-HN01, VNUA-TN08 và VNUA-HP11. Xác định 3 chủng này thuộc 3 nhóm di truyền là Q1-like, QX-like và TC07-2-like, có quan hệ gần gũi nguồn gốc và dịch tễ học với Trung Quốc. - Khẳng định dịch bệnh IB vẫn xảy ra ở đàn có vacxin nếu không có kháng nguyên tương đồng giữa chủng vacxin và chủng cường độc lưu hành. 1.5. Ý NGHĨA KHOA HỌC VÀ THỰC TIỄN CỦA ĐỀ TÀI 1.5.1. Ý nghĩa khoa học của đề tài - Luận án đã phân tích, đánh giá và chỉ ra một số đặc điểm dịch tễ học mô tả của bệnh IB tại một số tỉnh phía Bắc Việt Nam: tỷ lệ lưu hành bệnh, đặc điểm lưu hành bệnh theo độ tuổi gà và theo mùa vụ. Xác định được một số yếu tố có liên quan đến sự lưu hành bệnh IB trên gà. - Xác định được 10 chủng IBV lưu hành trên địa bàn nghiên cứu; khi phân tích, đánh giá chuyên sâu về mặt di truyền cho thấy 3 chủng IBV phân lập được thuộc 3 kiểu di truyền khác nhau, các chủng này đều có mức tương đồng thấp với các chủng vacxin IB hiện đang lưu hành trên thị trường - Luận án là tài liệu tham khảo tốt phục vụ cho những nghiên cứu khoa học tiếp theo về IB, IBV và là tư liệu tham khảo cho giảng dạy trong chuyên ngành thú y. 1.5.2. Ý nghĩa thực tiễn của đề tài - Khẳng định dịch bệnh IB vẫn xảy ra ở đàn có vacxin nếu không có kháng nguyên tương đồng giữa chủng vacxin và chủng cường độc lưu hành. - Phân lập thành công 10 chủng IBV và khảo sát đặc tính virus học qua nuôi cấy trên phôi gà 10 ngày tuổi, trong đó có chủng có thể phát triển thành chủng vacxin ứng dụng trong thực tế. - Kết quả của luận án là cơ sở khoa học cần thiết và sát với thực tế để người chăn nuôi, cũng như các nhà quản lý hiểu rõ hơn và đề ra các giải pháp phòng, chống IB hiệu quả hơn. PHẦN 2 TỔNG QUAN TÀI LIỆU 2.1. ĐẶC TÍNH SINH HỌC CỦA IBV Bệnh viêm phế quản truyền nhiễm (Infectious bronchitis - IB) là một bệnh truyền nhiễm cấp tính của gà, do virus viêm phế quản truyền nhiễm (Infectious bronchitis virus - IBV), thuộc giống Coronavirus, họ Coronaviridae, bộ Nidovirales gây ra. Hầu hết các chủng IBV đều bị vô hoạt sau 15 phút ở 56oC và sau 90 phút ở 45oC, cho thấy bản chất dễ vỡ của virus. IBV mẫn cảm với các chất sát trùng thông thường 2 và bị bất hoạt bởi chloroform và các dung môi lipid, vì vậy có thể dùng dung dịch β – propiolactone 0,05% hoặc 0,1% (BPL), formalin 0,1% để tiêu diệt căn bệnh. IBV rất dễ lây lan, thời kỳ ủ bệnh tương đối ngắn (18-36 giờ). IBV lan truyền theo đường ngang qua không khí, dụng cụ chăn nuôi, thức ăn, nước uống. Bệnh lây chủ yếu qua đường hô hấp. Dù xâm nhập vào cơ thể bằng con đường nào thì IBV cũng đến ký sinh và sinh sản trong các tế bào biểu mô hô hấp làm các tế bào này bị thoái hóa và chết. Trong thể bệnh kéo dài, IBV xâm nhập và tác động vào cơ quan sinh dịch, ống dẫn trứng, các mô đường tiêu hoá và thận. IBV gây nên sự trì trệ hoạt động mao khí quản, gây giảm sản lượng và chất lượng trứng, ảnh hưởng đến ống dẫn trứng. Ngoài ra, IBV còn gây nên các tổn thương thận, mức độ nghiêm trọng phụ thuộc vào từng chủng, gây bệnh về ruột và đường tiêu hoá của gà. Tính gây bệnh của IBV phụ thuộc chủng virus, ngoài ra còn có sự ảnh hưởng của các mầm bệnh thứ sinh, lứa tuổi, chế độ ăn của gà, thời tiết… IBV thích nghi với hầu hết các biểu mô trên gà. Và thích ứng khi nuôi cấy trên phôi gà 9-11 ngày tuổi; trên môi trường tế bào như tế bào thận phôi gà, tế bào thận gà, tế bào gan phôi gà, ngoài ra một số chủng còn nhân lên được trên tế bào VERO của động vật có vú, tế bào BHK-21; và trên môi trường nuôi cấy tổ chức khí quản. 2.2. ĐẶC ĐIỂM PHÂN TỬ CỦA IBV IBV là một RNA virus, sợi đơn dương với bộ gen dài khoảng 27 kb. Tổ chức bộ gen điển hình của virus theo thứ tự 5’-Pol-S-3a-3b-E-M-5a-5b-N-UTR-3’. Sự tái tổ hợp di truyền được biết đến như một đặc điểm của IBV. Nhưng phạm vi của các sự kiện tái tổ hợp giữa các dòng phân lập thực địa IBV vẫn chưa được hiểu rõ. IBV hiện nay có rất nhiều biến chủng với các serotype khác nhau. Sự khác biệt giữa các serotype chủ yếu là ở gen protein S1. Khi so sánh toàn bộ trình tự protein S, hầu hết các serotype của IBV đều có 80 đến 90% tương đồng giữa các serotype khác nhau. Trong S2, độ tương đồng amino acid thường là ≥90%. Hầu hết các serotype IBV khác nhau từ 20-25% trình tự amino acid S1, mặc dù với một số chủng khác biệt lên đến 50% và những chủng khác sự khác biệt chỉ nhỏ bằng 2-3%. Những nghiên cứu đột biến đối với các kháng thể đơn dòng đã cho thấy nhiều amino acid liên quan đến sự hình thành của các epitope VN được đặt trong khu vực thứ nhất và thứ ba của chiều dài polipeptide S1. Phân tích trình tự của các biến thể có di truyền rất giống nhau (>95% axit amin tương đồng trong S1) cho thấy phần lớn sự khác biệt nằm trong hai vùng này. Việc tạo ra các biến thể di truyền được cho là kết quả từ sự thay đổi vài amino acid trong glycoprotein spike (S) của IBV. Hầu hết các nghiên cứu trên IBV tập trung trên gen glycoprotein S. 3 PHẦN 3 VẬT LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU 3.1. NỘI DUNG 3.1.1. Ứng dụng kỹ thuật RT-PCR để chẩn đoán phát hiện IBV và nghiên cứu biến đổi bệnh lý IB - Ứng dụng kỹ thuật RT-PCR trong chẩn đoán phát hiện IBV, khảo sát cặp mồi được sử dụng. - Nghiên cứu một số đặc điểm bệnh lý IB trên gà. 3.1.2. Nghiên cứu một số đặc điểm dịch tễ IB ở gà tại một số tỉnh miền Bắc Việt Nam - Tình hình mắc IB ở gà tại một số tỉnh miền Bắc Việt Nam: + Tỉ lệ gà mắc IB ở các lứa tuổi; + Tỉ lệ gà mắc IB theo các mùa trong năm. - Xác định một số yếu tố nguy cơ chủ yếu. 3.1.3. Phân lập và xác định một số đặc tính sinh học của các chủng IBV phân lập được - Phân lập IBV trên trứng gà sạch có phôi; - Xác định tính thích ứng của các IBV trên phôi gà; - Xác định liều gây nhiễm phôi 50% (EID50/ml) và liều gây chết phôi 50% (ELD50/ml) của một số chủng IBV phân lập được. 3.1.4. Phân tích trình tự gen và xây dựng cây phả hệ + Giải trình tự gen, xác định type IBV phân lập được; + Xây dựng cây phả hệ. 3.2. ĐỊA ĐIỂM NGHIÊN CỨU - Nghiên cứu được thực hiện tại các trang trại và hộ chăn nuôi tại một số tỉnh thành miền Bắc Việt Nam (Bắc Ninh, Hà Nội, Hải Phòng, Hưng Yên, Thái Nguyên); - Phòng thí nghiệm Bộ môn Bệnh lý thú y - Học viện Nông nghiệp Việt Nam; - Phòng thí nghiệm Trung tâm Chẩn đoán Thú y DABACO; - Phòng thí nghiệm Công ty TNHH MTV AVAC Việt Nam (AVAC); - Công ty Marcrogen, Hàn Quốc và COSMO (Genetech Co., Ltd, Seoul, Hàn Quốc). 3.3. VẬT LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU 3.3.1. Vật liệu nghiên cứu: 3.3.1.1. Vật liệu nghiên cứu cho nội dung 1 - Các cặp mồi sử dụng: + Mồi đặc hiệu antisense : 5’-AGT GGT CTG GTT CAC-3’. + Cặp mồi khuếch đại đoạn gen S1: Mồi xuôi IBF : 5’-TTTTGGTGATGACAAGATGAA-3’; Mồi ngược IBR : 5’-CGCATTGTTCCTCTCCTC-3’. - Các chủng virus truyền nhiễm bao gồm: chủng virus vacxin Nobilis IB 4-91, chủng virus Lasota, chủng Nobilis Gumboro 228E, chủng virus NIBRG-14, chủng 4 Nobilis ILT. Các cặp mồi đặc hiệu dùng trong chẩn đoán của các virus kể trên. - Gà chết trên địa bàn nghiên cứu đã được chọn; - Dụng cụ mổ khám, dụng cụ lấy mẫu xét nghiệm, trang bị bảo hộ; - Bộ dụng cụ làm tiêu bản; - Bộ hóa chất tẩm đúc paraffin và nhuộm Haematoxylin – Eosin (HE); - Bộ kit tách chiết RNA: Trizol® Reagent (Life technologies, USA); - Bộ kit phiên mã ngược SuperScript®III First-Strand kit (Invitrogen, MA, US); - Bộ kit PCR AccuPower® PCR PreMix (BIONEER); - Máy móc thí nghiệm cần thiết: máy RT-PCR, máy đọc gel, máy điện di, máy ly tâm, tủ lạnh, buồng an toàn sinh học cấp 2. 3.3.1.2. Vật liệu nghiên cứu cho nội dung 2 * Số liệu và phần mềm - Số liệu các ổ dịch IB, đàn gà, số gà mắc IB và số gà chết do IB tại các trang trại và hộ chăn nuôi trên địa bàn nghiên cứu; - Số liệu điều tra trong nghiên cứu xác định các yếu tố liên quan; - Phần mềm sử dụng trong xử lý số liệu Excel 2007 và Minitab 16.0. 3.3.1.3. Vật liệu nghiên cứu cho nội dung 3 - Trứng gà từ những con gà sạch bệnh, đặc biệt không có kháng thể IB, có phôi 10 ngày tuổi do Công ty TNHH MTV AVAC Việt Nam (AVAC) cung cấp; - Tủ lạnh, tủ lạnh âm, tủ ấm, máy ấp trứng...; - Trang bị bảo hộ: găng tay và khẩu trang, áo blouse. 3.3.1.4. Vật liệu nghiên cứu cho nội dung 4 * Các cặp mồi được sử dụng: - Cặp mồi khuếch đại gen S1:Mồi xuôi: 5’- AAGACTGAACAAAARACCGACT -3’; Mồi ngược: 5’- CAAAACCTRCCATAACTWACATA -3’; - Cặp mồi khuyếch đại gen S dài đầy đủ: Mồi xuôi 5'-CGG AAC AAA AGA CMG ACT TAG T-3'; Mồi ngược 5'-CCA TTA AAC AGA CTT TTT AGG TCT G-3'; - Cặp mồi đặc hiệu vector M13F và M13R; - Các bộ kit được sử dụng như: QIAquick PCR Purification (QIAgen), Plasmid Miniprep (QIAgen); - pGEM®-T Easy vector sử dụng enzyme T4 DNA ligase (Promega); - Trang bị bảo hộ; - Máy móc thí nghiệm cần thiết; - Phần mềm sử dụng trong phân tích trình tự gen và xây dựng cây phả hệ: phần mềm DNASTAR Lasergene và BioEdit 6.0; chương trình PHYLIP suite và phần mềm MEGA 7.0… 3.3.2. Phương pháp nghiên cứu 3.3.2.1. Phương pháp nghiên cứu cho nội dung 1 - Kiểm tra tính bắt cặp của mồi bằng BLAST, chọn mẫu theo sác xuất; - Chiết tách RNA virus, tổng hợp cDNA, PCR sử dụng các bộ kit thích hợp. Kiểm tra sản phẩm bằng điện di trên gel agarose 1-1,5%; 5 - Mẫu bệnh phẩm gà nghi mắc IB được lấy dựa trên TCVN 01-83:2011/BNNPTNT. Mẫu bệnh phẩm là khí quản, phổi, buồng trứng, thận của gà; - Mổ khám theo phương pháp của Thomas Carlyle Jones đối với gia cầm; - Phương pháp làm tiêu bản vi thể tẩm đúc bằng paraffin và nhuộm Haematoxylin – Eosin (HE) theo quy trình của Bộ môn Bệnh lý, Khoa Thú y, Học viện Nông nghiệp Việt Nam. 3.3.2.2. Phương pháp nghiên cứu cho nội dung 2 Điều tra dịch tễ sử dụng phương pháp dịch tễ học mô tả, thống kê sinh học, phương pháp hồi cứu, nghiên cứu Bệnh-Chứng. 3.3.2.3. Phương pháp nghiên cứu cho nội dung 3 - Phân lập IBV trên trứng gà sạch có phôi 10 ngày tuổi theo quy trình của OIE (2018). - Xác định khả năng thích ứng và ổn định của IBV trên phôi gà: mỗi chủng IBV phân lập được cấy truyền 3 đợt trên phôi trứng gà sạch 10 ngày tuổi, mỗi đợt 30 phôi trứng. Theo dõi thí nghiệm trong 6 ngày, đánh giá bệnh tích và tổng hợp số liệu phôi sống, chết ở từng thời điểm, đánh giá kết quả. - Xác định EID50/ml và ELD50/ml: pha loãng nối tiếp các IBV phân lập theo thứ tự -1 10 , 10-2...đến 10-8. Gây nhiễm liều 0,1ml mỗi nồng độ với 5 phôi trứng gà. Theo dõi thí nghiệm ở các thời điểm 24, 48, 72, 96 và 120 giờ, tổng hợp số liệu phôi chết, phôi sống, phôi nhiễm và phôi không nhiễm. Tính EID50/ml và ELD50/ml theo công thức của Spearman-Karber. 3.3.2.4. Phương pháp nghiên cứu cho nội dung 4 - Sản phẩm PCR được xử lý và gửi ra nước ngoài để giải trình tự. Phân tích bằng phần mềm DNASTAR Lasergene (DNASTAR®), BioEdit 6.0. - Cây phả hệ được xây dựng dựa vào thuật toán Neighbor-joining algorithms của chương trình PHYLIP suite và phần mềm MEGA 7.0. Cấu trúc hình học của cây phả hệ được đánh giá dựa vào phương pháp Bootstrap re-sampling 1.000 lần dữ liệu Neighbor-joining từ SEQBOOT and CONSENSE của chương trình PHYLIP suite. PHẦN 4 KẾT QUẢ VÀ THẢO LUẬN 4.1. ỨNG DỤNG KỸ THUẬT RT-PCR ĐỂ CHẨN ĐOÁN PHÁT HIỆN IBV VÀ NGHIÊN CỨU BIẾN ĐỔI BỆNH LÝ IB 4.1.1. Ứng dụng kỹ thuật RT-PCR trong chẩn đoán phát hiện IBV Kiểm tra tính bắt cặp nucleotide của cặp mồi IBF/IBR (Feng et al., 2012) cho kết quả bắt cặp tốt với hơn 100 dữ liệu gen S và hệ gen đầy đủ của IBV trong GenBank. Thử nghiệm bằng RT-PCR cho kết quả nhạy và đặc hiệu. Kết quả chẩn đoán có 126/260 (48,46%) mẫu bệnh phẩm cho kết quả dương tính với IBV (Bảng 4.1). 6 Bảng 4.1. Kết quả chẩn đoán IB bằng phương pháp RT-PCR Nơi Số mẫu xét nghiệm Số mẫu dương tính lấy mẫu (n) (n) Bắc Ninh 68 36 52,94 Hà Nội 32 15 46,88 Hải Phòng 54 24 44,44 Hưng Yên 56 26 46,43 Thái Nguyên 50 25 50,00 Tính chung 260 126 48,46 Tỷ lệ (%) dương tính 4.1.2. Kết quả nghiên cứu một số biến đổi bệnh lý IB ở gà 4.1.2.1. Triệu chứng lâm sàng của gà mắc IB Nghiên cứu về những biểu hiện lâm sàng của gà nhiễm IB có ý nghĩa quan trọng trong chẩn đoán lâm sàng khi có dịch bệnh xảy ra. Kết quả quan sát trực tiếp trên những đàn, trại có mẫu bệnh phẩm cho kết quả RT-PCR dương tính với IBV cho thấy 100% gà bệnh có hiện tượng hô hấp khó khăn như hắt hơi, thở khó, dịch mũi tiết ra nhiều và kèm theo là các biểu hiện sưng đầu, viêm kết mạc, đây cũng là những biểu hiện đặc trưng của bệnh (Bảng 4.2). Ngoài ra, gà mắc IB còn có thêm triệu chứng tích dịch trong tử cung, đặc biệt có ở gà mắc IB. Thêm nữa, gà còn bị tiêu chảy phân loãng, nhiều nước và có mùi hôi thối (Bảng 4.2). Bảng 4.2. Kết quả nghiên cứu triệu chứng lâm sàng chủ yếu của gà mắc IB Triệu chứng lâm sàng Sốt, ủ rũ, ăn kém Hô hấp khó khăn* Sưng đầu Viêm kết mạc Tích dịch trong tử cung Phân tiêu chảy nhiều nước Trại A (Bắc Ninh) ++ +++ ++ + + + Trại B (Hà Nội) Trại C (Hải Phòng) Trại D (Hưng Yên) Trại E (Thái Nguyên) +++ ++ +++ ++ +++ +++ +++ ++ ++ ++ ++ ++ ++ + + + + + + + ++ + + + Nơi lấy mẫu Chú thích: +++: Nặng; ++: Trung bình; +: Nhẹ; * Hô hấp khó khăn, bao gồm: Hắt hơi, thở khó, dịch mũi tiết ra nhiều 4.1.2.2. Một số biến đổi bệnh lý đại thể của gà mắc IB Bệnh tích của gà mắc IB rất đa dạng, trong đó chiếm tỷ lệ cao gồm thận sưng (90,48%), viêm kết mạc mắt (76,98%), tích dịch trong tử cung (66,67%); ngoài ra chủ yếu là các bệnh tích đường hô hấp như xuất huyết khí quản (76,98%), phổi tụ huyết, xuất huyết (63,49%), viêm túi khí (60,32%) và viêm xoang mũi (57,94%) (Bảng 4.3). Bảng 4.3. Kết quả nghiên cứu biến đổi bệnh lý đại thể của gà mắc IB 7 Số gà nghiên cứu (n) 126 126 126 126 126 126 126 126 126 126 126 Bệnh tích Viêm kết mạc Viêm xoang mũi Xuất huyết khí quản Phổi tụ huyết, xuất huyết Viêm túi khí Báng nước xoang bụng Buồng trứng viêm, teo Ống dẫn trứng teo Ống dẫn trứng tích nước Thận sưng Thận sưng tích urat Số gà có bệnh tích (n) 50 73 97 80 76 84 34 20 10 114 2 Tỷ lệ (%) 39,68 57,94 76,98 63,49 60,32 66,67 26,98 15,87 7,94 90,48 1,59 Ngoài tế bào niêm mạc đường hô hấp và thận bị tác động, IBV còn tác động vào cơ quan sinh dục làm biến đổi tổ chức của cơ quan này hậu quả là sản lượng trứng thương phẩm của gà đẻ giảm nghiêm trọng và đây được coi là một trong những thiệt hại kinh tế nghiêm trọng đối với ngành chăn nuôi gà đẻ. Kết quả đánh giá tỷ lệ đẻ trứng của gà đẻ được thể hiên ở Bảng 4.4. Bảng 4.4. Sản lượng trứng của gà đẻ mắc IB Địa điểm Trại F (Bắc Ninh) Trại G (Hà Nội) Trại H (Hải Phòng) Trại I (Hưng Yên) Trại J (Thái Nguyên) Tuổi của Số gà Số Tỷ lệ đẻ thực gà quan sát trứng tế (%) (tuần tuổi) (con) (quả) (95% CI) 32 4500 23124 23 5000 12950 25 3000 11260 27 29 4000 3500 16268 15325 73,41 (72,12-74,70) 37,00 (35,66-38,34) 53,62 (51,84-55,40) 58,10 (56,57-59,63) 62,55 (60,95-64,15) Tỷ lệ đẻ tiêu chuẩn (%) 94,20 80,00 92,50 94,00 94,50 Tỷ lệ trứng tụt giảm (%) (95% CI) 20,79a (19,60-21,98) 43,00a (41,63-44,37) 38,88a (37,14-40,63) 35,90a (34,41-37,39) 31,95a (30,41-33,49) Chú thích: Ký tự a thể hiện số liệu sai khác có ý nghĩa thống kê P < 0,05 Tỷ lệ tụt giảm sản lượng trứng cũng khác nhau ở các lứa tuổi gà đẻ khác nhau (Bảng 4.4). Cụ thể gà đẻ 23 tuần tuổi mắc IB có tỷ lệ (%) tụt giảm sản lượng trứng là cao nhất 43,00% (95% CI 41,63 - 44,37) và gà đẻ 32 tuần tuổi mắc IB có tỷ lệ (%) tụt giảm sản lượng trứng là thấp nhất 20,79% (95% CI 19,60-21,98). Sự chênh lệch giữa 8 tỷ lệ (%) trứng tụt giảm cao nhất và thấp nhất là 22,21% (95% CI 20,40 – 24,02) (ɀ = 24,00; <0,001). Kết quả cho thấy tỷ lệ (%) trứng tụt giảm của gà đẻ mắc IB cao hơn khi số tuần tuổi của gà mắc càng nhỏ. 4.1.2.3. Một số biến đổi bệnh lý vi thể của gà mắc IB Kết quả nghiên cứu bệnh tích vi thể của 10 con gà mắc IB (kiểm tra dương tính với IBV bằng phản ứng RT-PCR) có các biển đổi bệnh lý đại thể đặc trưng cho thấy hầu hết các cơ quan trong cơ thể gà mắc bệnh đều có biến đổi bệnh lý vi thể. Tiêu biểu là thâm nhiễm tế bào viêm có ở 100% số mẫu nghiên cứu và tất cả các cơ quan trong cơ thể (Bảng 4.5). Các bệnh tích vi thể bao gồm: biểu mô khí quản xuất huyết, sung huyết và bong tróc; niêm mạc hạ khí quản phù nề, biểu mô bong tróc kết hợp với dịch thẩm xuất; phế nang xuất huyết tràn lan, viêm mạch quản, thành mạch dày và sung huyết. Xuất huyết kẽ thận, tế bào ống thận thoái hóa không bào; lắng đọng muối urate ống thận, dịch rỉ viêm và hồng cầu kẽ thận ... đều chiếm tỷ lệ 100% tiêu bản nghiên cứu. Bảng 4.5. Nghiên cứu biến đổi bệnh lý vi thể Biến đổi bệnh lý vi thể Cơ quan nghiên Số nghiên cứu cứu Sung Xuất Hoại tử huyết huyết tế bào Thoái Thâm hoá tế nhiễm TB bào viêm Khí quản 10 10/10 10/10 4/10 6/10 10/10 Phổi 10 6/10 8/10 6/10 10/10 10/10 Thận 10 10/10 10/10 2/10 10/10 10/10 Buồng trứng 10 6/10 6/10 2/10 6/10 10/10 Ống dẫn trứng 10 8/10 10/10 2/10 6/10 10/10 4.2. ĐẶC ĐIỂM DỊCH TỄ IB Ở GÀ TẠI MỘT SỐ TỈNH MIỀN BẮC VIỆT NAM 4.2.1. Tình hình dịch IB ở gà tại một số tỉnh miền Bắc Việt Nam 4.2.1.1. Tình hình gà mắc bệnh IB tại một số tỉnh miền Bắc Việt Nam Nghiên cứu điều tra được thực hiện trên gà nuôi theo hướng đẻ trứng thương phẩm trên địa bàn 5 tỉnh thành phố miền Bắc Việt Nam gồm: Bắc Ninh, Hà Nội, Hải Phòng, Hưng Yên và Thái Nguyên. Kết quả điều tra trên tổng số 197.229 con gà nuôi hướng trứng có 28.999 con gà mắc IB chiếm tỷ lệ 14,70% (95% CI 14,54 - 14,86), trong đó có 4.828 con gà chết do IB tương đương với tỷ lệ 2,45% (95% CI 2,38 - 2,52). Tỷ lệ (%) gà mắc IB trong nghiên cứu dao động từ 13,16-16,26%. Tỷ lệ (%) gà chết do IB trong nghiên cứu dao động từ 2,02-2,54% (Bảng 4.6). Bảng 4.6. Tỉ lệ gà mắc IB trên địa bàn nghiên cứu 9 Tỉnh/TP Số điều tra (con) Số mắc (con) Bắc Ninh 41.315 6.718 Hà Nội 41.250 6.439 Hải Phòng 32.470 4.342 Hưng Yên 44.045 5.800 Thái Nguyên 38.149 5.699 Tổng 197.229 28.999 Tỷ lệ (%) mắc (95% CI) 16,26a (15,90-16,62) 15,61a (15,26-15,96) 13,37a (13,00-13,74) 13,16a (12,84-13,48) 14,93a (14,57-15,29) 14,70 (14,54-14,86) Số chết (con) 836 920 738 1.096 968 4.828 Tỷ lệ (%) chết (95% CI) 2,02a (1,88-2,16) 2,23a (2,09-2,37) 2,27a (2,11-2,43) 2,49a (2,34-2,64) 2,54a (2,38-2,70) 2,45 (2,38-2,52) Chú thích: Ký tự a thể hiện số liệu sai khác có ý nghĩa thống kê P < 0,05 4.2.1.2. Tình hình gà mắc IB theo lứa tuổi Kết quả nghiên cứu thu được cho thấy gà thuộc tất cả các lứa tuổi đều có thể mắc IB (Bảng 4.7). Bảng 4.7. Tỷ lệ gà mắc IB theo lứa tuổi gà trên địa bàn nghiên cứu Tuổi gà (tuần) Số điều tra (con) Số mắc (con) ≤17 23.108 4.060 18-27 65.562 10.656 28-37 73.138 9.310 >37 35.421 4.973 Tổng 197.229 28.999 Tỷ lệ (%) mắc (95% CI) 17,57a (17,08-18,06) 16,25a (15,97-16,53) 12,73a (12,49-12,97) 14,04a (13,68-14,40) 14,70 (14,54-14,86) Số chết (con) Tỷ lệ (%) chết (95% CI) 1.738 7,52a (7,18-7,86) 1.622 939 2,47a (2,35-2,59) 1,28a (1,20-1,36) 529 1,49a (1,36-1,62) 4.828 2,45 (2,38-2,52) Chú thích: Ký tự a thể hiện số liệu sai khác có ý nghĩa thống kê P < 0,05 Tỷ lệ (%) gà mắc IB trung bình là 14,70%, tỷ lệ gà mắc IB cao nhất ở giai đoạn ≤ 17 tuần tuổi (17,57%) cao hơn so với tỷ lệ gà mắc IB thấp nhất ở giai đoạn gà 28-37 tuần tuổi (12,73%) là 4,84% (p<0,001). Tỷ lệ gà chết vì IB theo lứa tuổi cũng tuân theo quy luật của tỷ lệ gà mắc IB (Bảng 4.7) trung bình là 2,45%. Với tỷ lệ (%) gà chết do IB cao nhất ở gà ≤ 17 tuần tuổi, tỷ lệ chết lên đến 7,52%. Tỷ lệ gà chết thấp nhất ở giai đoạn gà từ 28 – 37 tuần tuổi với 10 1,28%. Sự chênh lệch về tỷ lệ chết ở gà do IB giữa 2 giai đoạn này là tương đối lớn với 6,24% (p < 0,001). Sự chênh lệch về tỷ lệ chết giữa giai đoạn gà còn non ≤ 17 tuần tuổi với các giai đoạn còn lại tương đối cao, điều này chứng tỏ sức đề kháng và chống chịu với IB của gà ở giai đoạn này là rất thấp. 4.2.1.3. Tình hình gà mắc IB theo mùa Dưới sự ảnh hưởng khác nhau của thời tiết, nhiệt độ và độ ẩm mỗi mùa thì tỷ lệ gà mắc IB cũng như tỷ lệ gà chết do IB đã có sự khác biệt. Kết quả điều tra về tỷ lệ mắc IB và tỷ lệ chết do IB trên gà theo các mùa trong năm đã được tổng hợp (Bảng 4.8). Mùa đông có tỷ lệ (%) gà mắc IB cao nhất là 20,50% (p < 0,001), thấp nhất là mùa thu với 10,48% (p < 0,005). Mùa hè và mùa thu có tỷ lệ mắc bệnh chênh lệch nhau không đáng kể. Trong khi đó, sự chênh lệch giữa tỷ lệ mắc cao nhất vào mùa đông và thấp nhất vào mùa thu là tương đối lớn 10,02% (p < 0,001). Tỷ lệ chết cũng tập trung từ mùa đông của năm trước và mùa xuân của năm sau, tỷ lệ chết lần lượt là 4,23% và 3,06% cao hơn 2 mùa còn lại. Tỷ lệ chết cũng thấp nhất vào mùa thu với 1,21% thấp hơn so với mùa đông là 3,02% (p < 0,001) (Bảng 4.8). Bảng 4.8. Tỷ lệ gà mắc IB theo mùa trên địa bàn nghiên cứu Mùa Số gà theo dõi Số mắc Tỷ lệ (%) mắc Số chết trong năm (con) (con) (95% CI) (con) 53.043 9.109 49.845 5.644 Mùa xuân (Tháng 2-4) Mùa hè (Tháng 5-7) Mùa thu (Tháng 8-10) Mùa đông (Tháng 11-1) Tổng hợp 50.844 5.327 43.497 8.919 197.229 28.999 17,17a (16,85-17,49) 11,32a (11,04-11,60) 10,48a (10,21-10,75) 20,50a (20,12-20,88) 14,70 (14,54-14,86) 1.624 746 616 1.842 4.828 Tỉ lệ (%) chết (95% CI) 3,06a (2,91-3,21) 1,50a (1,39-1,61) 1,21a (1,11-1,31) 4,23a (4,04-4,42) 2,45 (2,38-2,52) Ký tự a thể hiện số liệu khác nhau có ý nghĩa thống kê (p < 0,05) Từ các kết quả nghiên cứu dịch tễ, bệnh IB thường xuyên xảy ra 5 tỉnh/thành miền Bắc. Ngoài các yếu tố về nguyên nhân gây bệnh, thì các yếu tố ngoại cảnh (mùa vụ chăn nuôi...) và yếu tố vật chủ (lứa tuổi gà...) ảnh hưởng rất lớn đến sự lây lan IB và mức độ nghiêm trọng của bệnh. Vì vậy, để có biện pháp kiểm soát dịch bệnh, cũng như sử dụng vacxin thích hợp, cần phải tính đến các yếu tố ảnh hưởng đó, khắc phục nếu được cũng là một phương pháp quản lý phòng chống dịch bệnh tốt. 4.2.2. Xác định một số yếu tố liên quan đến bệnh IB 11 4.2.2.1. Yếu tố phương thức chăn nuôi Nhiều nghiên cứu đã cho thấy phương thức chăn nuôi là một yếu tố quan trọng trong sự lây lan các dịch bệnh truyền nhiễm. Phương thức chăn nuôi là một yếu tố có ảnh hưởng rất lớn đến sự phát triển và lưu hành IB trên gà. Bảng 4.9. Yếu tố nguy cơ về phương thức chăn nuôi Yếu tố khảo sát Kết quả Tổng Chăn nuôi công nghiệp Chăn nuôi chăn thả Bệnh 43 32 75 Không bệnh 227 283 510 Tổng 270 315 585 OR (95% CI) 1,68 (1,03 – 2,73) Chitest (P-value) 3,027 x 10 -228(<0,001) OR=1,68 (95% CI 1,03 – 2,73) (Bảng 4.9), cho thấy odd có bệnh của nhóm chăn nuôi công nghiệp cao hơn 1,68 lần odd có bệnh của nhóm chăn nuôi chăn thả hay nói cách khác nhóm chăn nuôi công nghiệp có khả năng bị bệnh gấp 1,68 lần so với nhóm chăn nuôi chăn thả (p<0,001). 4.2.2.2. Yếu tố quy mô chăn nuôi Trong chăn nuôi, quy mô chăn nuôi là một yếu tố có ảnh hưởng đến nguy cơ bệnh dịch. Quy mô càng lớn làm tăng nguy cơ bệnh vì khi trại có quy mô càng lớn thì càng phức tạp hơn trong vấn đề quản lý nên khó kiểm soát trường hợp mầm bệnh được truyền từ bên ngoài vào. Bảng 4.10. Yếu tố nguy cơ về quy mô chăn nuôi Yếu tố khảo sát Kết quả Tổng Quy mô đàn >1000 con Quy mô đàn <1000 con Bệnh 16 59 75 Không bệnh 63 447 510 Tổng 79 506 585 OR (95% CI) 1,92 (1,04 – 3,55) Chitest (P-value) 0,026 (<0,05) OR=1,92 (95% CI 1,04 – 3,55) (Bảng 4.10) cho thấy odd có bệnh IB của những đàn có quy mô >1000 con cao hơn odd có bệnh IB của những đàn có quy mô <1000 con, những đàn có quy mô >1000 con có khả năng bị bệnh cao hơn 1,92 lần so với những đàn có quy mô <1000 con (p<0,05). 4.2.2.3. Yếu tố tiêm phòng vacxin 12 Công tác tiêm phòng vacxin cho gia súc, gia cầm là rất cần thiết và có ích vì nó có thể bảo vệ cho sản xuất, đảm bảo cho ngành chăn nuôi phát triển an toàn và bền vững. Đối với IB cũng vậy, vacxin vẫn đóng vai trò quan trọng trong phòng bệnh và giảm thiểu tối đa nguy cơ lây nhiễm cũng như gây chết trên đàn gia cầm. Bảng 4.11. Yếu tố nguy cơ về tiêm phòng vacxin IB Yếu tố khảo sát Kết quả Tổng Không tiêm phòng Tiêm phòng vacxin vacxin đầy đủ đầy đủ Bệnh 29 46 75 Không bệnh 145 365 510 Tổng 174 411 585 OR (95% CI) 1,59 (0,96 – 2,62) Chitest (P-value) 1,392 x 10-53 (<0,001) OR=1,59 (Bảng 4.11) có nghĩa là odd bị bệnh của những đàn không tiêm phòng vacxin đầy đủ cao hơn 1,59 lần so với odd bị bệnh của những đàn có tiêm phòng vacxin đầy đủ. Kết quả trên cho thấy yếu tố về tiêm phòng vacxin IB có liên quan đến bệnh IB (p< 0,001). Những đàn không tiêm phòng vacxin đầy đủ có khả năng mắc bệnh IB cao hơn khả năng không mắc bệnh 1,59 lần. Tuy nhiên, với 95% CI của OR (0,96 – 2,62) cho thấy có thể trong những nghiên cứu khác, kết quả lại ngược lại, tức là những đàn không tiêm phòng vacxin IB có khả năng mắc bệnh IB thấp hơn mặc dù với tỷ lệ không cao (khoảng dưới 4%). 4.2.2.4. Yếu tố nguồn cung cấp con giống Một trong những yếu tố để kiểm soát dịch bệnh được tốt chính là kiểm soát được nguồn cung cấp giống. Bảng 4.12. Yếu tố nguy cơ về nguồn gốc giống Yếu tố khảo sát Nhiều nguồn giống khác Nguồn giống ổn định, Kết quả Tổng nhau không đảm bảo đảm bảo Bệnh 23 52 75 Không bệnh 133 377 510 Tổng 156 429 585 OR (95% CI) 1,25 (0,74 – 2,13) Chitest (P-value) 2,533 x 10-37 (<0,05) Tỷ số OR =1,25 (95% CI 0,74 – 2,13) (Bảng 4.12) cho thấy những đàn có nguồn gốc giống không đảm bảo có khả năng bị bệnh cao hơn 1,25 lần so với khả năng bị bệnh của những đàn có nguồn gốc giống đảm bảo. Kết quả này có thể thay đổi trong 13 những nghiên cứu khác, tuy nhiên có thể kết luận rằng nguồn gốc giống có liên quan đến khả năng bị bệnh IB trên gà. 4.2.2.5. Yếu tố vị trí trang trại Vị trí trang trại là yếu tố được đánh giá thông qua giá trị khoảng cách: khoảng cách tới trang trại chăn nuôi gà gần nhất, khoảng cách từ trang trại đến lò giết mổ, và khoảng cách từ trang trại đến chợ buôn bán gia cầm, trạm trung chuyển. Yếu tố về khoảng cách địa lý thật ra còn có thể xem như là yếu tố đại diện cho nhiều yếu tố khác liên quan đến nguy cơ lây truyền mầm bệnh. Bảng 4.13. Yếu tố nguy cơ về vị trí trang trại Bệnh Không bệnh Tổng OR (95% CI) Chitest (P-value) Kết quả Yếu tố khảo sát Cách trại khác, lò giết mổ, Cách trại khác, lò giết chợ buôn bán, trạm trung mổ, chợ buôn bán, trạm chuyển <1000 mét trung chuyển >1000 mét 31 44 177 333 208 377 1,33 (0,81 – 2,17) 2,803 x 10-99 (<0,001) Tổng 75 510 585 Kết quả với OR=1,33 (95% CI 0,81 – 2,17) (Bảng 4.13), chúng tôi kết luận những đàn có vị trí trang trại gần với các trang trại khác, lò giết mổ, chợ buôn bán hay trạm trung chuyển (<1000 mét) là yếu tố có liên quan với dịch IB với khả năng có dịch IB cao hơn 1,33 lần so với những đàn có vị trí trang trại xa hơn (>1000 mét) (p < 0,001). 4.2.2.6. Yếu tố vệ sinh chuồng trại IBV có thể lây nhiễm qua môi trường không khí ẩm thấp, phân và các thiết bị chăn nuôi bị nhiễm mầm bệnh, nhất là sau khi có gia cầm mắc bệnh, cần phải cách ly và khử trùng chuồng trại rồi mới tiếp tục với những lứa gà tiếp theo. Chính vì vậy đây cũng là một trong những yếu tố có thể làm lây lan và tái phát dịch bệnh. Bảng 4.14. Yếu tố nguy cơ về vệ sinh chuồng trại Yếu tố khảo sát Kết quả Tổng Không vệ sinh (hoặc vệ Có vệ sinh thường sinh đã lâu >6 tháng) xuyên Bệnh 26 49 75 Không bệnh 116 394 510 Tổng 142 443 585 OR (95% CI) 1,80 (1,07 – 3,03) Chitest (P-value) 7,998 x10-26 (<0,001) Phân tích các kết quả thu được, với OR=1,80 (95% CI 1,07 – 3,30) (Bảng 4.14), chúng tôi xác định yếu tố vệ sinh chuồng trại có liên quan đến khả năng bị bệnh IB (p < 0,001), những đàn không được vệ sinh chuồng trại, hoặc không vệ sinh thường xuyên có khả năng bị nhiễm IB cao hơn 1,66 lần so với những đàn có vệ sinh chuồng trại thường xuyên. 14 4.3. PHÂN LẬP VÀ XÁC ĐỊNH MỘT SỐ ĐẶC TÍNH SINH HỌC CỦA CÁC CHỦNG IBV PHÂN LẬP ĐƯỢC 4.3.1. Phân lập IBV trên trứng gà sạch có phôi Trong nghiên cứu này, 10 chủng IBV mới đã được phân lập thành công 5 đời qua phôi trứng, 7 chủng phân lập được ở đời thứ nhất (Bảng 4.15). Bảng 4.15. Thông tin về các chủng IBV phân lập được Phân lập (Ký hiệu chủng) Viết tắt Năm ck/VN/VNUA-HN01/2014 VNUA-HN01 2014 5 ck/VN/VNUA-HN02/2014 VNUA-HN02 2014 5 ck/VN/VNUA-HN03/2014 VNUA-HN03 2014 ck/VN/VNUA-HN04/2014 VNUA-HN04 2014 5 ck/VN/VNUA-HN05/2014 ck/VN/VNUA-TN06/2015 VNUA-HN05 VNUA-TN06 2014 2015 5 5 ck/VN/VNUA-TN07/2015 ck/VN/VNUA-TN08/2015 VNUA-TN07 VNUA-TN08 2015 2015 ck/VN/VNUA-TN09/2015 ck/VN/VNUA-HP10/2015 ck/VN/VNUA-HP11/2015 ck/VN/VNUA-HP12/2015 VNUA-TN09 VNUA-HP10 VNUA-HP11 VNUA-HP12 2015 2015 2015 2015 ck/VN/VNUA-HP13/2015 ck/VN/VNUA-HY14/2015 ck/VN/VNUA-BN15/2015 VNUA-HP13 VNUA-HY14 VNUA-BN15 2015 2015 2015 Hưng Yên 1 5 1 ck/VN/VNUA-BN16/2015 VNUA-BN16 2015 Bắc Ninh 1 ck/VN/VNUA-BN17/2015 VNUA-BN17 2015 Tỉnh/TP Hà Nội Thái Nguyên Hải Phòng Đời (P) 5 1 5 1 5 5 1 1 4.3.2. Xác định một số đặc tính sinh học của các chủng IBV phân lập được 4.3.2.1. Khả năng thích ứng và ổn định của các chủng IBV phân lập được trên phôi gà Kết quả xác định các chủng IBV phân lập được có tính thích ứng rất cao và ổn định trên phôi gà, biểu hiện ở bệnh tích đặc trưng trên phôi và gây chết phôi ở từng thời điểm tương đối ổn định khi gây nhiễm các chủng virus này trên phôi gà. Tỷ lệ phôi chết của các chủng dao động từ 83,33% đến 100%. Đối với mỗi chủng tỷ lệ phôi chết dao động giữa các đợt thí nghiệm không quá 3,33% sau 144 giờ. Thời gian gây chết phôi tập trung vào khoảng từ 25 giờ đến 72 giờ sau khi tiêm truyền. 4.3.2.2. Kết quả xác định EID50/ml và ELD50/ml Kết quả liều gây nhiễm phôi và liều gây chết phôi 50% của các chủng IBV phân lập dao động từ 104,3 đến 107,5EID50/ml và 102,3 đến 105,5ELD50/ml (Bảng 4.16). Độc lực của các chủng virus phân lập đánh giá qua khả năng gây nhiễm và gây chết phôi khác nhau. Như vậy ở miền Bắc Việt Nam hiện đang lưu hành nhiều chủng IBV gây bệnh có độc lực khác nhau. Với 2 chủng độc lực thấp là VNUA-TN06 và VNUA-HP10 15 và 3 chủng cường độc mà chúng tôi phân lập được là VNUA-HY14, VNUA-HN01, VNUA-HN04. Bảng 4.16. Kết quả tính EID50/ml và ELD50/ml STT Mã hóa mẫu EID50/ml ELD50/ml 1 VNUA-HN01 106,9 104,7 2 VNUA-HN02 106,1 104,1 3 VNUA-HN03 106,1 104,1 4 VNUA-HN04 107,3 105,1 5 VNUA-HN05 106,1 104,3 6 VNUA-TN06 104,3 102,3 7 VNUA-TN08 106,3 104,5 8 VNUA-HP10 104,3 102,5 9 VNUA-HP11 104,5 103,3 10 VNUA-HY14 107,5 105,5 4.4. PHÂN TÍCH TRÌNH TỰ GEN VÀ XÂY DỰNG CÂY PHẢ HỆ 4.4.1. Phân tích trình tự gen S1 và xây dựng cây phả hệ Kết quả nghiên cứu đã giải trình tự thành công gen S1 của chủng virus ck/VN/VNUA-HN01/2014 (VNUA-HN01). Phân tích và so sánh trình tự nt và aa giữa chủng VNUA-HN01 với các chủng tham chiếu (SCLS/140104, I2022/13, DY09, Chongqing/0908, LSD/08-10, LDL/97I, LDL/98I, Q1, và J2) cho thấy mức độ tương đồng cao giữa chúng, tương đương với 99,6-99,9% về nt và 99,3-100% về aa (Bảng 4.17). Điều này cho thấy mối quan hệ di truyền mật thiết giữa chủng VNUA-HN01 Việt Nam với các chủng tham chiếu này. Bảng 4.17. Mức độ tương đồng về nucleotide và amino acid của chủng VNUAHN01 so sánh với các chủng tham chiếu Chủng VNUA-HN01 SCLS/140104 LSD/08-10 DY09 Chongqing/0908 J2 Q1 LDL/98I I2022/13 LDL/97I 4/91. Ma5 VNUAHN01 SCLS/140104 100 99.88 99.88 99.81 99.81 99.69 99.69 99.63 99.88 99.56 74.99 72.62 100 99.94 99.94 99.81 99.81 99.75 100 99.69 74.99 72.62 LSD/0810 100 100 99.94 99.94 99.81 99.81 99.75 100 99.69 74.99 72.62 DY09 100 100 100 99.88 99.75 99.75 99.69 99.94 99.63 75.08 72.71 Chongqing /0908 J2 Q1 Tương đồng amino acid (%) 99.81 99.44 99.44 99.81 99.44 99.44 99.81 99.44 99.44 99.81 99.44 99.44 99.25 99.25 99.25 99.75 99.75 99.75 99.69 99.56 99.56 99.94 99.81 99.81 99.63 99.63 99.5 74.9 74.9 74.81 72.53 72.62 72.44 Tương đồng nucloetide(%) 16 LDL/98I I2022/13 LDL/97I 99.63 99.63 99.63 99.63 99.44 99.06 99.06 99.75 99.94 74.63 72.34 100 100 100 100 99.81 99.44 99.44 99.63 99.69 74.99 72.62 99.25 99.25 99.25 99.25 99.06 99.06 98.69 99.63 99.25 74.72 72.43 4/91. Ma5 73.2 73.2 73.2 73.2 72.96 73.2 72.96 72.71 73.2 72.96 71.23 71.23 71.23 71.23 70.98 71.48 70.98 70.73 71.23 70.98 70.73 74.43 ck/VN/VNUA-HN01/2014 cK/CH/SCLS/140104 CK/CH/LSD/08-10_S1 DY09 CK/CH/Chongqing/0908 J2 Q1 CK/CH/LDL/98I CoV/Ck/Italy/I2022/13 ck/CH/LDL/97I 4/91 Ma5 10 20 30 40 50 60 70 80 90 100 ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....| MLGKSLFIVTLLFALCSAALFDNNETVYYYQSAFRPADGWHLHGGAYAVVNVSLETNNAGTASQCIAGAISWSKNFSASAVAMTAPELGMTWSTGQFCTA .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... ....P.LL...WY.....L.Y.K.TY..........GQ...........DK.FNG....VSV.D.T..TFYE.Y.I..AS....V.PA..S..VA..... ..VTP.LL....C.......Y.SSSY..........P..............I.S.S....SS.G.TV.I.HGGRVVN..SI.....SS..A..SS..... ck/VN/VNUA-HN01/2014 cK/CH/SCLS/140104 CK/CH/LSD/08-10_S1 DY09 CK/CH/Chongqing/0908 J2 Q1 CK/CH/LDL/98I CoV/Ck/Italy/I2022/13 ck/CH/LDL/97I 4/91 Ma5 110 120 130 140 150 160 170 180 190 200 ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....| HCNFSDFTVFVTHCFKHGNGLCPLTGLIPSGFIRVSAMRKGSNSLFYNLTVSVTKYPRFKSLQCVNNYTSVYLNGDLVFTSNETKPVSAAGVSFKAGGPI .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... ..........................F......................................................................... ..............................................................................................T..... .................................................................................................... ..................D...........................................................................T..... ................SQQ.S.....M..QNH..I....S.--F.........S...K.......G.S............P...TH.TG...Y..S...V Y.....T.......Y...G--..I..MLQQHS......KN.--Q.........A...T...F.....L..........Y...A.TD.TS...Y....... ck/VN/VNUA-HN01/2014 cK/CH/SCLS/140104 CK/CH/LSD/08-10_S1 DY09 CK/CH/Chongqing/0908 J2 Q1 CK/CH/LDL/98I CoV/Ck/Italy/I2022/13 ck/CH/LDL/97I 4/91 Ma5 210 220 230 240 250 260 270 280 290 300 ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....| TYKTMSEVKVLAYFVNGTAQTVIPCDGSPRGLLACQYNTGNFSDGFYPYTNSSLVKERFIVYRESSVNTTLVLTNFTFSNVSNAPPNTGGVHSIVLHQTQ .................................................................................................... .................................................................................................... .................................................................................................... .........................G.......................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... ...V.K...A....I.....E..L..N.....................F.......D.........T....E......T.....S..S...DTFQ.Y..H ...V.R..RA..........D..L........................F.......QK......N.....FT.H....H.ETG.N..PS..QN.QTY... ck/VN/VNUA-HN01/2014 cK/CH/SCLS/140104 CK/CH/LSD/08-10_S1 DY09 CK/CH/Chongqing/0908 J2 Q1 CK/CH/LDL/98I CoV/Ck/Italy/I2022/13 ck/CH/LDL/97I 4/91 Ma5 310 320 330 340 350 360 370 380 390 400 ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....| TAQSGYYNFNFSFLSSFRYVESDFMYGSYHPKCSFRLETINNGLWFNSLSVSLGYGPLQGGCKQSVFNNMATCCYAYSYSGPTLCKGVYSGQLQKTFECG .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... ......................Y....................................................................E........ .................................................................................................... .T.................................................................................................. .................................................................................................... .T.........................................................................................E........ ...D......L......V.KP..........N.N..P.N..............T...I.........S.K.........R...R.....R.E.TQY.... .................V.K..N........S.N..................IA.............SGR.........G..L........E.DHN.... ck/VN/VNUA-HN01/2014 cK/CH/SCLS/140104 CK/CH/LSD/08-10_S1 DY09 CK/CH/Chongqing/0908 J2 Q1 CK/CH/LDL/98I CoV/Ck/Italy/I2022/13 ck/CH/LDL/97I 4/91 Ma5 410 420 430 440 450 460 470 480 490 500 ....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....| LLVFVTKSDGSRIQTRNEPLVLTQHNYNNITLNKCVEYNIYGRVGQGLITNITDSAANHGYLADGGLAVLDTSGAIDVFVVQGVYGLTYYKVNPCEDVNQ .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... .................................................................................................... ...Y............S.......Y......................F...V.EAT..YS........I........I...R.A...N............ ...Y....G......AT..P.I...........T..D......T...F...V....VSYN....A...I.....S..I....SE...N............ ck/VN/VNUA-HN01/2014 cK/CH/SCLS/140104 CK/CH/LSD/08-10_S1 DY09 CK/CH/Chongqing/0908 J2 Q1 CK/CH/LDL/98I CoV/Ck/Italy/I2022/13 ck/CH/LDL/97I 4/91 Ma5 510 520 530 540 ....|....|....|....|....|....|....|....|. QFVVSGGQLVGILTSRNETGSQPIENRFYVKFPNSRRRTGR ......................................... ......................................... ......................................... ......................................... ................................L........ ................................L...S.... ......................................... ......................................... ......................................... .......N.......H...D.EF...Q..I.LT.GT..SR. .......K..............LL..Q..I.IT.GT..FR. Hình 4.1. So sánh trình tự amino acid giữa chủng IBV ck/VN/VNUA-HN01/2014 với các chủng tham chiếu Ngược lại, VNUA-HN01 chia sẻ mức độ tương đồng về nt và aa thấp hơn nhiều khi so sánh với hai chủng trong vacxin IBV (4/91 và Ma5) sử dụng tại Việt Nam, tương đương với 72,6-74,9% về nt và 71,2-73,2% về aa (Bảng 4.17). Mức độ tương đồng thấp về nt và aa giữa chủng virus thực địa với chủng virus vacxin cho thấy mức độ phù hợp của các vacxin này trong phòng bệnh đối với chủng virus thực địa không cao dẫn đến không đạt hiệu quả cao trong phòng chống bệnh. Phân tích cây phả hệ cho thấy chủng VNUA-HN01 thuộc vào nhóm Q1-like cùng các chủng phân lập từ Trung Quốc và Italy (Hình 4.2). Cũng dựa trên cây phả hệ chủng VNUA-HN01 được phân nhóm có khoảng cách xa so với các chủng 4/91, Ma5 và H120 có trong IBV hiện đang lưu hành tại Việt Nam. So sánh trình tự aa cho thấy chủng VNUA-HN01 có nhiều hơn 2 aa ở vị trí 142S, 143N so sánh với chủng vacxin 4/91, và nhiều hơn 4 aa ở vị trí 120G, 121L, 142S, và 143N khi so sánh với chủng vacxin Ma5 (Hình 4.1). Khẳng định mối quan hệ xa giữa 17 chủng VNUA-HN01 và các chủng IBV vacxin được sử dụng, điều này cho thấy vụ dịch xảy ra tại Ba Vì, Hà Nội năm 2014 không phải là do vacxin gây nên. Phân tích cây phả hệ xây dựng dựa trên trình tự hoàn chỉnh của gen S1 cho thấy các chủng IBV được phân chia thành 6 genotype với 32 nhóm di truyền khác nhau. Trong nghiên cứu này, chủng VNUA-HN01 thuộc vào GI-16 lineage cùng với các chủng IBV Q1-like phân lập từ Trung Quốc và Italy. GU938413.1 CK/CH/Chongqing/0908 KP780179.1 CoV/Ck/Italy/I2022/13 GQ258325.1 CK/CH/LSD/08-10 S1 KU364607.1 cK/CH/SCLS/140104 AF286303.1 J2 Q1-like AF286302.1 Q1 DQ167132.1 CK/CH/LDL/98I JX195177.1 ck/CH/LDL/97I 92 100 HM113491.1 DY09 93 ck/VN/VNUA-HN01/2014 KF377577 4/91 73 4/91 FJ807652.1 H120 99 100 Mass KU736747 Ma5 GQ504725.1 Mass41 Vaccine AY606322.1 T07/02 98 GQ229232.1 3382/06 100 KP790146.1 CK/CH/LHLJ/140901 96 Taiwan HQ185567.1 CK/TW/T15/2006 97 AY606318.1 3051/02 100 KX107712.1 CK/CH/GX/GL1412-1 99 DQ646405.2 TW2575/98 JQ920402.1 11044 JQ920378.1 K2 100 KM91 JQ977698.1 KM91 JQ920386.1 1123 100 AY702975.1 LDT3 100 AY646283.1 partridge/GD/S14/2003 DQ288927.1 SAIBK 80 A 2-like EU526388.1 A2 89 KX252787.1 ck/CH/LLN/131040 89 100 AF193423.1 QXIBV AY189157.1 LX4 KX302874.1 ck/CH/LGS/131148 KX219791.1 ck/CH/LHLJ/07I 93 100 98 QX-like JX840411.1 YX10 KC692312.1 CK CH HB CZ1108 KJ524621.1 CK/CH/ZJ/HZ12 KX107636.1 CK/CH/AH/HF1302-2 KM365469.1 GX-QZ130064 KU361188.1 CK/CH/2014/QL1403 100 KF668605.1 CK/CH/SD09/005 TC07-like KF663559.1 ck/CH/IBTZ/2012 79 GQ265948.1 TC07-2 0 .0 5 Hình 4.2. Cây phả hệ phân tích mối tương quan giữa gen S1 của chủng IBV ck/VN/VNUA-HN01/2014 với các chủng tham chiếu 4.4.2. Phân tích trình tự gen S của các chủng IBV phân lập được từ thực địa Trong nghiên cứu này, 3 chủng virus ck/VN/VNUA-HN01/2014 (VNUA-HN01), ck/VN/VNUA-TN08/2015 (VNUA-TN08) và ck/VN/VNUA-HP11/2015 (VNUAHP11) đã được giải toàn bộ trình tự gen S. Kết quả phân tích và so sánh trình tự nt và chuỗi aa đã được tóm tắt (Bảng 4.18). Gen S của 3 chủng virus VNUA-HN01, VNUA-TN08 và VNUA-HP11 có mức độ tương đồng về trình tự nucleotide cao nhất tương ứng với 3 chủng virus là CK/Italy/I2022/13 (100%), CK/CH/LHLJ/08-6 (98,9%) và GX-NN120084 (99,4%). Kết quả so sánh trình tự nt và aa của gen S giữa các chủng virus IB phân lập trong nghiên cứu này cho thấy mức độ tương đồng với nhau rất thấp, cụ thể mức độ tương đồng tương ứng là 62,7- 77,4% về nt và 66,8-82,5% về aa. Khi so sánh với 2 chủng virus vacxin đang sử dụng phổ biến ở Việt Nam là IBV 4/91 và Ma5, mức độ tương đồng về trình tự nt và aa của 3 chủng virus VNUA-HN01, VNUA-TN08 và VNUA18
- Xem thêm -